PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00067.1_g00053.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 256aa    MW: 28678.4 Da    PI: 4.5886
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00067.1_g00053.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.42.8e-373592461
                   zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                             +a +cprC s+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rk+ +s
  Rsa1.0_00067.1_g00053.1 35 TAPPCPRCASSNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNIPVGGGCRKRSRS 92
                             5668**************************************************8765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-253486IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5283791IPR003851Zinc finger, Dof-type
PfamPF027011.0E-313791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MMLPYNAHNS YQPQFPSSEI EIPEKWKVPY GHDETAPPCP RCASSNTKFC YYNNYSLSQP  60
RYFCKGCRRY WTKGGSLRNI PVGGGCRKRS RSRHNSSHKR FGRNNENLQP DGAMNQDDGS  120
HSSPAGSDID LAAVFAQYVT NGSPSSTDNT TGSDQDSLTT HALDSLSWDI CQETDVNLGF  180
YGELNNLTEK IQEGLGQFLQ EDQEEMFKFQ GLLDDKEIQE ILECSFSGEP DQLISQGSFM  240
INGDNWSSTD LTTFGI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18792KRSRSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149653.11e-162PREDICTED: dof zinc finger protein DOF1.2
SwissprotP683491e-151DOF12_ARATH; Dof zinc finger protein DOF1.2
TrEMBLA0A078IJR11e-164A0A078IJR1_BRANA; BnaA06g15080D protein
STRINGBra017906.1-P1e-162(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM64622643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21340.11e-141Dof family protein